.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d0f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the BIG_1156.2 domain of putative penicillin-binding protein MrcA from Nitrosomonas europaea ATCC 19718. TO BE PUBLISHED
    Site MCSG
    PDB Id 3d0f Target Id APC87353.2
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS5882,CAD86229.1, BIG_1156.2, 228410 Molecular Weight 11363.49 Da.
    Residues 103 Isoelectric Point 9.57
    Sequence yrgpeaflklpkdlkdrealqdimqdignsddilaavvlsatpgaveafrkngetiritgdglkaahrf lsndpkigekrirpgalirvkktekgswqivqlp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.64 Rfree 0.217
    Matthews' coefficent 2.31 Rfactor 0.170
    Waters 378 Solvent Content 46.67

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3d0f
    1. The other 90% of the protein: Assessment beyond the C_s for CASP8 template_based and high_accuracy models
    DA Keedy, CJ Williams, JJ Headd - Proteins: Structure, , 2009 - Wiley Online Library
     
    2. Target domain definition and classification in CASP8
    ML Tress, I Ezkurdia - : Structure, Function, and , 2009 - Wiley Online Library
     
    3. 2-v2: template-based protein structure prediction server
    CC Chen, JK Hwang, JM Yang - BMC bioinformatics, 2009 - biomedcentral.com
     
    4. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch