The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a TetR transcription regulator from Haloarcula marismortui ATCC 43049. To be Published
    Site MCSG
    PDB Id 3crj Target Id APC88200
    Molecular Characteristics
    Source Haloarcula marismortui atcc 43049
    Alias Ids TPS5903,YP_134709.1, PF00440.13, 272569 Molecular Weight 22438.68 Da.
    Residues 196 Isoelectric Point 4.41
    Sequence magpsdrtfsdqteeimqatyralrehgyadltiqriadeygkstaavhyyydtkddllaafldyller fvdsihdvettdpearlnllldellvkpqenpdlsvallemrsqapykeafsdrfrqndeyvrymlkav inhgidegvftdvdaehvtrslltiidgartravmlddteeletarqtaseyadamlq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.28789
    Matthews' coefficent 2.94 Rfactor 0.23355
    Waters Solvent Content 58.23

    Ligand Information
    Metals CL (CHLORIDE) x 1


    Google Scholar output for 3crj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch