.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cqb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of heat shock protein HtpX domain from Vibrio parahaemolyticus RIMD 2210633. To be Published
    Site MCSG
    PDB Id 3cqb Target Id APC91272.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6020,NP_797497.1, 223926 Molecular Weight 11051.91 Da.
    Residues 104 Isoelectric Point 4.96
    Sequence skgmalrsvggmviesprnetehwlletvgrqaqqagigmptvaiydsadinafatgakrddslvavst gllhnmtrdeaeavlahevshiangdmvtmtlmqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.86 Rfree 0.19227
    Matthews' coefficent 2.33 Rfactor 0.15234
    Waters 194 Solvent Content 47.25

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 5;GOL (GLYCEROL) x 1
    Metals CL (CHLORIDE) x 1;NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 3cqb
    1. Polymorphic toxin systems: comprehensive characterization of trafficking modes, processing, mechanisms of action, immunity and ecology using comparative
    D Zhang, RF de Souza, V Anantharaman, LM Iyer - Biology , 2012 - biology-direct.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch