.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cp0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from Corynebacterium glutamicum. To be Published
    Site MCSG
    PDB Id 3cp0 Target Id APC20537.1
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS5204,CAF21542.1, 196627 Molecular Weight 8591.36 Da.
    Residues 79 Isoelectric Point 8.44
    Sequence rpairkrllkpkvldsspralvghraevledvgatsgqvrldgsiwsarsmdpthtfaegeivsvidiq gttaivwkea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.21594
    Matthews' coefficent 2.04 Rfactor 0.17174
    Waters 52 Solvent Content 39.59

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1;ZN (ZINC) x 3

    Jmol

     
    Google Scholar output for 3cp0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch