.
The Open Protein Structure Annotation Network
PDB Keyword
.

3col

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative transcription regulator from Lactobacillus plantarum. To be Published
    Site MCSG
    PDB Id 3col Target Id APC88984
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS5933,NP_786395.1, PF00440.13, 220668 Molecular Weight 21368.37 Da.
    Residues 193 Isoelectric Point 9.00
    Sequence mkkkdmnkqvkiqdavaaiilaegpagvsttkvakrvgiaqsnvylyfknkqalidsvyaretnrilst tdldrlsdstidvttrirlyvqqvydyslanpdsltiiqqikalngqgmtisaadadpnnivanlltaa idakvikqlpvslhmgvvfstihthttniskgryaqdqytfgdifqmiwdamkqd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.24618
    Matthews' coefficent 2.29 Rfactor 0.18536
    Waters 302 Solvent Content 46.21

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3col

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch