.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cnv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the ligand-binding domain of a putative GntR-family transcriptional regulator from Bordetella bronchiseptica. To be Published
    Site MCSG
    PDB Id 3cnv Target Id APC7627
    Molecular Characteristics
    Source Bordetella bronchiseptica rb50
    Alias Ids TPS5174,NP_890218.1, 257310 Molecular Weight 29102.69 Da.
    Residues 259 Isoelectric Point 9.03
    Sequence maearpdsltrsraakpagegaafsplyrqikellvqsldrgewkpgelipseidlaarfqvsqgtvrk avdelaaehlllrrqgkgtfvathhearvryrflrlapdeegeggraesrilecrrlrapaeiaralel ragetvvtirrqlsmnhmptviddlwlpgthfrgltlelltaskaplyglfesefgvsmvradeklrav aaspeiapllgvepgrpllqvdrisytygdrpmevrrglyltdhyhyrnsln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.217
    Matthews' coefficent 2.77 Rfactor 0.164
    Waters 395 Solvent Content 55.60

    Ligand Information
    Ligands FLC (CITRATE) x 4
    Metals CL (CHLORIDE) x 5

    Jmol

     
    Google Scholar output for 3cnv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch