.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cng

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of NUDIX hydrolase from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 3cng Target Id APC7497
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS5143,NP_841215.1, 228410 Molecular Weight 21290.49 Da.
    Residues 185 Isoelectric Point 6.39
    Sequence mkfcsqcggevilripegdtlpryicpkchtihyqnpkvivgcipewenkvllckraiapyrgkwtlpa gfmennetlvqgaaretleeanarveirelyavyslphisqvymlfraklldldffpgieslevrlfge qeipwndiafrvihdplkrymeerhhgqpafhlgiinkpqagsnsne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.233
    Matthews' coefficent 2.62 Rfactor 0.181
    Waters 344 Solvent Content 53.02

    Ligand Information
    Ligands GOL (GLYCEROL) x 4;EDO (1,2-ETHANEDIOL) x 3
    Metals CL (CHLORIDE) x 7;ZN (ZINC) x 4;NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 3cng

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch