The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a conserved protein of unknown function from Enterococcus faecalis V583. To be Published
    Site MCSG
    PDB Id 3clq Target Id APC29596.3
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5464,AAO82696.1, BIG_561.1, 226185 Molecular Weight 44705.88 Da.
    Residues 418 Isoelectric Point 4.86
    Sequence ptlyekiqqaneeavtriiqskpilvgfdkainvmpdmtettilhagppityenmcgpmkgavqgalvf eglakdladadrvarsgaitfspchehdavgsmagvtspnmyvhiiknetygntaftnlseqlakvlrf gandqsvvdrliwmrdvlgpllhdamtfcpegidlrlmlsqalhmgdechnrnvagstllvqaltpymv qtdfsreqlkevfeflgssdyfsgptwmgaakcaldaghnvenstivttmcrngvefgirvsgiggnhw ftgpaqrvigpmfagytqedagldmgdsaitetygvggfamaaapaivplvggtvaealnyskemleit tkenpnvtipvldfmgiptgidvlkvletgmlpvintaiahkepgigmigagltnppanvfnealkalvatin
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.23972
    Matthews' coefficent 2.79 Rfactor 0.18322
    Waters 49 Solvent Content 55.88

    Ligand Information


    Google Scholar output for 3clq

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch