.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ck2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved uncharacterized protein (predicted phosphoesterase COG0622) from Streptococcus pneumoniae TIGR4. To be Published
    Site MCSG
    PDB Id 3ck2 Target Id APC80634
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5614,AAK75951, 170187 Molecular Weight 19853.40 Da.
    Residues 173 Isoelectric Point 5.20
    Sequence makqtiivmsdshgdsliveevrdryvgkvdavfhngdselrpdsplwegirvvkgnmdfyagyperlv telgstkiiqthghlfdinfnfqkldywaqeeeaaiclyghlhvpsawlegkilflnpgsisqprgtir eclyarveiddsyfkvdfltrdhevypglskefsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.203
    Matthews' coefficent 2.92 Rfactor 0.148
    Waters 132 Solvent Content 57.89

    Ligand Information
    Ligands SRT (S,R) x 1
    Metals MN (MANGANESE) x 2;CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3ck2
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch