.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cj8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase from Enterococcus faecalis V583. To be Published
    Site MCSG
    PDB Id 3cj8 Target Id APC86892
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5871,AAO80933.1, BIG_621.1, 226185 Molecular Weight 24616.34 Da.
    Residues 233 Isoelectric Point 5.12
    Sequence mdayeiiqyigdakkqtlvkvtlkgqlkevtfpetikvfnncktgtlfgdwadvkpfleankekiedyv vendarnsaipfldlkdinariepgalirekveigdqavimmgailnigavvgagtmidmgavlggrat vgkhchigagtvlagvieppsaapvvienevviganavvlegvrvgegavvaagavvvedvpahtvvag vpakvikqiddktkskteileelrkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.95 Rfree 0.24845
    Matthews' coefficent 2.43 Rfactor 0.20131
    Waters 515 Solvent Content 49.42

    Ligand Information
    Ligands FMT (FORMIC) x 7;ACT (ACETATE) x 1;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals MG (MAGNESIUM) x 1;CL (CHLORIDE) x 6

    Jmol

     
    Google Scholar output for 3cj8
    1. The three-dimensional Structure of a mycobacterial DapD provides insights into DapD diversity and reveals unexpected particulars about the enzymatic mechanism
    L Schuldt, S Weyand, G Kefala, MS Weiss - Journal of molecular biology, 2009 - Elsevier
     
    2. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of tetrahydrodipicolinate-N-succinyltransferase (Rv1201c) from
    L Schuldt, S Weyand, G Kefala - Section F: Structural , 2008 - scripts.iucr.org
     
    3. Tetrahydrodipicolinate N-Succinyltransferase and Dihydrodipicolinate Synthase from Pseudomonas aeruginosa: Structure Analysis and Gene Deletion
    R Schnell, W Oehlmann, T Sandalova, Y Braun - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch