.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cdl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a TetR family transcriptional regulator from Pseudomonas syringae pv. tomato str. DC3000. To be Published
    Site MCSG
    PDB Id 3cdl Target Id APC88582
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS5915,NP_793329.1, PF00440.13, 223283 Molecular Weight 22852.00 Da.
    Residues 200 Isoelectric Point 6.33
    Sequence mrltdqkresivqaaiaefgdrgfeitsmdriaaraevskrtvynhfpskeelfaemlqrlwncappqs evvyrplvslreqllellwgkmrnltdssfldlarvvvgatihsperaqvwlarinereetfsawiraa qkdgrlkpvdpgfaatqmhallksfafwpqvtfnaalltpqeqsnvvesalnmflgwyeipg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.36 Rfree 0.27514
    Matthews' coefficent 1.93 Rfactor 0.20667
    Waters 41 Solvent Content 36.39

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cdl
    1. Coordination chemistry of bacterial metal transport and sensing
    Z Ma, FE Jacobsen, DP Giedroc - Chemical reviews, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch