.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cbt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SC4828, a unique phosphatase from Streptomyces coelicolor. To be Published
    Site MCSG
    PDB Id 3cbt Target Id APC7349
    Related PDB Ids 3exm 
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5121,NP_629193.1, 100226 Molecular Weight 26412.14 Da.
    Residues 236 Isoelectric Point 5.78
    Sequence mtdgeavsaaagpgaegppgpvghwapgshilwryrenggphvhiarpvtvvrddadllavwlapgtec vkpvladgtpvhleplatrytkprtvqrdqwfgtgvlklarpgeawsvwlfwdpgwrfknwyvnlerpl trweggvdsedhfldisvhpdrtwhwrdedefaqalrdglmdpasagrvrragrsavaeirawgspfad gwehwrpdpawpvpslpgdwdrtpahvss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.21470
    Matthews' coefficent 2.31 Rfactor 0.18952
    Waters 319 Solvent Content 46.75

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 3;MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3cbt

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch