.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c8i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a putative membrane protein from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 3c8i Target Id APC90693.1
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5991,CAE49289.1, 1717 Molecular Weight 15530.81 Da.
    Residues 141 Isoelectric Point 5.06
    Sequence pkqvgnaqhlydnydlvpamiaevnprdmvvmalvntnvdptlpprwalatrnitaipgiegdtrkvgt ripavavtgqrsvgnqdswdqispmpiawatpdssviaraestipseqwttlsknlnkldqvretkfdl lel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.23164
    Matthews' coefficent 2.52 Rfactor 0.20021
    Waters 176 Solvent Content 51.19

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3c8i

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch