The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri. To be Published
    Site MCSG
    PDB Id 3c8h Target Id APC27316
    Related PDB Ids 3c87 3c8d 2b20 
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5387,AAP16019, 198215 Molecular Weight 45605.54 Da.
    Residues 400 Isoelectric Point 5.76
    Sequence mtalkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqnsqpqsmq riagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaiadplnpqswkgglg havsalempqaplqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaq smpvwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsdradrtv vagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagevsaeglrivleagire pmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglidlwqplfhdrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.48 Rfree 0.225
    Matthews' coefficent 2.30 Rfactor 0.183
    Waters 333 Solvent Content 46.44

    Ligand Information


    Google Scholar output for 3c8h

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    No description
    25.83 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch