.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c8g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The mannitol operon repressor MtlR belongs to a new class of transcription regulators in bacteria. J.Biol.Chem. 284 36670-36679 2009
    Site MCSG
    PDB Id 3c8g Target Id APC27974
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5396,AAP18223, 198215 Molecular Weight 19208.73 Da.
    Residues 169 Isoelectric Point 4.33
    Sequence matlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaqsgplddidv alrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvnsitrnatlydalkamkfa dfavwsearfsgmvktaltlavtttlkeltp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.27034
    Matthews' coefficent 2.53 Rfactor 0.20669
    Waters 12 Solvent Content 51.41

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3c8g
    1. New surface contacts formed upon reductive lysine methylation: Improving the probability of protein crystallization
    P Sledz, H Zheng, K Murzyn, M Chruszcz - Protein , 2010 - Wiley Online Library
     
    2. SYSTEM AND USES FOR GENERATING DATABASES OF PROTEIN SECONDARY STRUCTURES INVOLVED IN INTER-CHAIN PROTEIN INTERACTIONS
    AL Jochim, PS Arora - US Patent App. 12/753,638, 2010 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch