.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c8d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri. To be Published
    Site MCSG
    PDB Id 3c8d Target Id APC27316
    Related PDB Ids 3c87 3c8h 2b20 
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5386,AAP16019, 198215 Molecular Weight 45605.54 Da.
    Residues 400 Isoelectric Point 5.76
    Sequence mtalkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqnsqpqsmq riagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaiadplnpqswkgglg havsalempqaplqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaq smpvwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsdradrtv vagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagevsaeglrivleagire pmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglidlwqplfhdrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.194
    Matthews' coefficent 2.29 Rfactor 0.150
    Waters 1120 Solvent Content 46.30

    Ligand Information
    Ligands CIT (CITRIC) x 4
    Metals

    Jmol

     
    Google Scholar output for 3c8d

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch