.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c5o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the Conserved Protein of Unknown Function RPA1785 from Rhodopseudomonas palustris. To be Published
    Site MCSG
    PDB Id 3c5o Target Id APC7563
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS5155,NP_947130.1, 258594 Molecular Weight 17114.86 Da.
    Residues 153 Isoelectric Point 6.31
    Sequence mtptletkyvftitarigdvtsageigtgvrriipilggevkgegisgqvlpfgadfqiirpneliele akyafetddgavvyvenvgirfgpvellrklkrgepvdpkviyfrtrprfetghpnyqwlmqylfvgsa arhadrvvidvhqvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.271
    Matthews' coefficent 2.29 Rfactor 0.213
    Waters 289 Solvent Content 46.38

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3c5o

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch