The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the tagatose-6-phosphate ketose/aldose isomerase from Escherichia coli. To be Published
    Site MCSG
    PDB Id 3c3j Target Id APC7355
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS5125,AAC76170.1, 83333 Molecular Weight 41780.13 Da.
    Residues 384 Isoelectric Point 5.34
    Sequence mpenytpaaaatgtwteeeirhqprawirsltnidalrsalnnflepllrkenlriiltgagtsafigd iiapwlashtgknfsavpttdlvtnpmdylnpahplllisfgrsgnspesvaavelanqfvpecyhlpi tcneagalyqnainsdnafallmpaethdrgfamtssittmmasclavfapetinsqtfrdvadrcqai ltslgdfsegvfgyapwkrivylgsgglqgaaresalkvleltagklaafydsptgfrhgpkslvddet lvvvfvsshpytrqydldllaelrrdnqamrviaiaaessdivaagphiilppsrhfidveqafcflmy aqtfalmqslhmgntpdtpsasgtvnrvvqgviihpwqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.80 Rfree 0.18512
    Matthews' coefficent 2.23 Rfactor 0.13597
    Waters 2294 Solvent Content 44.95

    Ligand Information


    Google Scholar output for 3c3j

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch