.
The Open Protein Structure Annotation Network
PDB Keyword
.

3by6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a transcriptional regulator from Oenococcus oeni. To be Published
    Site MCSG
    PDB Id 3by6 Target Id APC89087
    Molecular Characteristics
    Source Oenococcus oeni psu
    Alias Ids TPS5936,YP_811307.1, PF00392.11, 203123 Molecular Weight 13466.81 Da.
    Residues 123 Isoelectric Point 9.70
    Sequence maitqkrpvylqlvdriknevatdvlsandqlpsvretalqekinpntvakaykeleaqkvirtipgkg tfitgntasvknsnqnrlladlsqviaeliksgvkgerikkivndilggknaen
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.20 Rfree 0.27786
    Matthews' coefficent 4.01 Rfactor 0.23875
    Waters 144 Solvent Content 69.35

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 3

    Jmol

     
    Google Scholar output for 3by6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch