The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the N-terminal domain of tetrahydrodipicolinate acetyltransferase from Staphylococcus aureus. TO BE PUBLISHED
    Site MCSG
    PDB Id 3bv8 Target Id APC86675.1
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mu50
    Alias Ids TPS5865,BAB57559.1, BIG_621.1, 158878 Molecular Weight 9708.36 Da.
    Residues 84 Isoelectric Point 4.43
    Sequence ltaeeiiqyisdakkstpikvylngnfegitypesfkvfgseqskvifceaddwkpfyeaygsqfedie iemdrrnsaiplkdl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.197
    Matthews' coefficent 3.93 Rfactor 0.175
    Waters 149 Solvent Content 68.67

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals NA (SODIUM) x 1


    Google Scholar output for 3bv8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch