.
The Open Protein Structure Annotation Network
PDB Keyword
.

3buu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of LolA superfamily protein NE2245 from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 3buu Target Id APC87350.1
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS5881,CAD86157.1, BIG_1154.4, 228410 Molecular Weight 25954.01 Da.
    Residues 226 Isoelectric Point 5.41
    Sequence ksavtaqsilekadeirfpqdsfqvnvairtaapdhaedlyryqvlskgnensivmitepasergqail mkgrdlwvfmpsvsqpirlslsqrltgqvangdiaranftgdyhpqllrnesiddedyyvleltgidrs vtyqkvllwvnqsnfrpykaefysvsgrllktsryenfdnilgemrptriimedalksgevsvldysdm klrdlpdkiftkdylkrle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.20 Rfree 0.19227
    Matthews' coefficent 1.75 Rfactor 0.15834
    Waters 449 Solvent Content 29.66

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3buu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch