.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bro

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Transcription Regulator MarR from Oenococcus oeni PSU-1. To be Published
    Site MCSG
    PDB Id 3bro Target Id APC89090
    Molecular Characteristics
    Source Oenococcus oeni psu
    Alias Ids TPS5938,YP_811351.1, PF01047.13, 203123 Molecular Weight 16050.92 Da.
    Residues 138 Isoelectric Point 9.68
    Sequence msrdlgrllkiasnqmstrfdifakkydltgtqmtiidylsrnknkevlqrdlesefsiksstatvllq rmeikkllyrkvsgkdsrqkclkltkkankletiilsymdsdqsqmtsglnkeevvflekilkrmiesd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.04 Rfree 0.247
    Matthews' coefficent 2.65 Rfactor 0.207
    Waters 451 Solvent Content 53.67

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3bro

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch