.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bpk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of nitrilotriacetate monooxygenase component B from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 3bpk Target Id APC25244
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5327,AAP12185, 226900 Molecular Weight 22224.16 Da.
    Residues 203 Isoelectric Point 5.61
    Sequence mlsinpneqtekdnyklltgsiiprpvafvtsvtkegvlngapysyfnivaanpplisvsvqrkagerk dtsrnaiekgefvvhisdesyvaainetaanlppneseielakltpiesevisvpgvkeanirmecvle raiplggtedspacdlligrvvrfhvaehlyekgrihaeglkpisrlaghnyaklgeqfelvrpi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.56 Rfree 0.1866
    Matthews' coefficent 2.78 Rfactor 0.1533
    Waters 522 Solvent Content 55.82

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals CL (CHLORIDE) x 4

    Jmol

     
    Google Scholar output for 3bpk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch