.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bp1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative 7-cyano-7-deazaguanine Reductase QueF from Vibrio cholerae O1 biovar eltor. To be Published
    Site MCSG
    PDB Id 3bp1 Target Id APC26423
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5357,AAF94064, 243277 Molecular Weight 32724.04 Da.
    Residues 287 Isoelectric Point 5.61
    Sequence mnrlknmskysdakelasltlgkkteyanqydpsllqpvprslnrndlhlsatlpfqgcdiwtlyelsw lnqkglpqvaigevsipatsanliesksfklylnsynqtrfaswdevqtrlvhdlsacagetvtvnvks lneytaepivtmqgeciddqdieianyefddallqgaaqgeevsevlhshllksnclitnqpdwgsvei ayhgakmnreallrylvsfrehnefheqcveriftdimrycqpqsltvyarytrrggldinpfrsshqs apnhnqrmarq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.53 Rfree 0.183
    Matthews' coefficent 2.05 Rfactor 0.143
    Waters 1177 Solvent Content 40.08

    Ligand Information
    Ligands GUN (GUANINE) x 4;PO4 (PHOSPHATE) x 6;POP (PYROPHOSPHATE) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3bp1
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Structural basis for polyproline recognition by the FE65 WW domain
    M Meiyappan, G Birrane, JAA Ladias - Journal of molecular biology, 2007 - Elsevier
     
    3. The tyrosine kinase Csk dimerizes through Its SH3 domain
    NM Levinson, PR Visperas, J Kuriyan - PloS one, 2009 - dx.plos.org
     
    4. High-resolution structure of the nitrile reductase QueF combined with molecular simulations provide insight into enzyme mechanism
    Y Kim, M Zhou, S Moy, J Morales - Journal of molecular , 2010 - Elsevier
     
    5. Interfacial water molecules in SH3 interactions: a revised paradigm for polyproline recognition
    M Jose, RS Javier, L Irene - Biochemical Journal, 2012 - biochemj.org
     
    6. Diversity of Archaeosine Synthesis in Crenarchaeota
    G Phillips, M Swairjo, K Gaston, M Bailly - ACS Chemical , 2012 - ACS Publications
     
    7. Structural Basis of Biological Nitrile Reduction
    VM Chikwana, B Stec, BWK Lee - Journal of Biological , 2012 - ASBMB
     
    8. Structural Basis of the Recognition of the SAMP Motif of Adenomatous Polyposis Coli by the Src-Homology 3 Domain
    S Kaieda, C Matsui, Y Mimori-Kiyosue, T Ikegami - Biochemistry, 2010 - ACS Publications
     
    9. Nitrile Reductases: A Forthcoming Wave in Biocatalysis?
    P Domnguez de Mara - ChemCatChem, 2011 - Wiley Online Library
     
    10. Structural Basis for TSC-1 TSC-2 Complex Formation
    JA Ladias - 2008 - DTIC Document
     
    11. Design of SH3 domain ligands using novel arginine mimetics and development of tunable EF-hand sensors of post translational modifications
    M Scheuermann - 2011 - putnam.lib.udel.edu
     
    12. Interfacial water molecules in SH3 interactions: Getting the full picture on polyproline recognition by protein-protein interaction domains
    A Zafra-Ruano, I Luque - FEBS letters, 2012 - Elsevier
     
    13. TUDE DE LA FONCTION DES RRO GAP AU COURS DU DVELOPPEMENT EMBRYONNAIRE DU NMATODE CAENORHABDITIS ELEGANS
    ENC DE LA MATRISE, BOULIER - 2010 - archipel.uqam.ca
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch