The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of TetR-family transcriptional regulator from Streptomyces coelicolor. To be Published
    Site MCSG
    PDB Id 3bni Target Id APC7281
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5107,NP_733542.1, 100226 Molecular Weight 23026.87 Da.
    Residues 205 Isoelectric Point 6.35
    Sequence mrtvshptplrrapvqrrsaerltrildacadlldevgydalstravalradvpigsvyrffgnkrqma dalaqrnleryaervterlteagdggwrgaldtvldeylamkrtapgfslidfgnqipvgdrhavpnhr vaerltellsgylgrrpdddlrrvflvavetadtlvqlafrvapdgdekiieearellraylgrvld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.249
    Matthews' coefficent 1.86 Rfactor 0.197
    Waters 80 Solvent Content 33.70

    Ligand Information
    Ligands PG4 (TETRAETHYLENE) x 2


    Google Scholar output for 3bni

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch