.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bj6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of MarR family Transcription Regulator SP03579. To be Published
    Site MCSG
    PDB Id 3bj6 Target Id APC89089
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS5937,YP_168774.1, PF01047.13, 246200 Molecular Weight 16611.16 Da.
    Residues 149 Isoelectric Point 9.76
    Sequence mthetdqlyqavqatrpllrnitaavergtlregvtvgqraileglsltpgatapqlgaalqmkrqyis rilqevqraglierrtnpeharshrywltprgeaiitairademaklalfsegfssveltayhkvqlal trffadlakea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.01 Rfree 0.198
    Matthews' coefficent 2.86 Rfactor 0.1612
    Waters 399 Solvent Content 57.07

    Ligand Information
    Ligands EOH (ETHANOL) x 7
    Metals

    Jmol

     
    Google Scholar output for 3bj6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch