.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bed

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray Crystal Structure of Mannose/sorbose specific IIa subunit of phosphotransferase system from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 3bed Target Id APC28805
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5419,AAO80316, 226185 Molecular Weight 14546.97 Da.
    Residues 139 Isoelectric Point 4.22
    Sequence mkpklilmshgrmaeetlastqmivgeladaaivsmtaedglsgtqaklaailkeagnvptlvladlkg gtpcnvammamgtypqlrvvaglnlamaieaavspvenvdelaayltqigqsavttidlpeltdeeefee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.1967
    Matthews' coefficent 2.13 Rfactor 0.1573
    Waters 330 Solvent Content 42.33

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bed

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch