.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b79

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-terminal peptidase C39 like domain of the toxin secretion ATP-binding protein from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 3b79 Target Id APC90972.3
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6003,NP_801246.1, BIG_527.5, 223926 Molecular Weight 13907.42 Da.
    Residues 126 Isoelectric Point 5.51
    Sequence mkdpllnsliyvsryyglanspealvnglplsdgkltpfllpraaeraglvakenraelekisslilpa ilvlkggdscvlnsinmetreaevttlesgmvpisipledlleqytgryflvkkqfr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.37 Rfree 0.182
    Matthews' coefficent 1.97 Rfactor 0.155
    Waters 173 Solvent Content 37.57

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3b79
    1. A bacterial type III effector family uses the papain-like hydrolytic activity to arrest the host cell cycle
    Q Yao, J Cui, Y Zhu, G Wang, L Hu - Proceedings of the , 2009 - National Acad Sciences
     
    2. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch