The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the PhiH1 repressor-like Protein from Haloarcula marismortui. To be Published
    Site MCSG
    PDB Id 3b73 Target Id APC88207
    Molecular Characteristics
    Source Haloarcula marismortui atcc 43049
    Alias Ids TPS5904,YP_136816.1, PF01047.13, 272569 Molecular Weight 12104.54 Da.
    Residues 108 Isoelectric Point 4.56
    Sequence mrqsgswmtiwddrileiiheegngspkeledrdeiriskssvsrrlkkladhdllqplangvyvitee geaylngeydagkeryinrgnstdeengadapdgpgins
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.12 Rfree 0.228
    Matthews' coefficent 2.31 Rfactor 0.194
    Waters 55 Solvent Content 46.87

    Ligand Information
    Ligands SO4 (SULFATE) x 2


    Google Scholar output for 3b73

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch