.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rk5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a domain of the putative hemolysin from Streptococcus mutans UA159. To be Published
    Site MCSG
    PDB Id 2rk5 Target Id APC86174.3
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS5835,AAN59330.1, PF03471, 210007 Molecular Weight 9638.20 Da.
    Residues 85 Isoelectric Point 4.46
    Sequence reiadntyivlgtmtlndfneyfetdlesdnvdtiagfyltgvgtipsqeekehfevesngkhlelind kvkdgrvtklkilvse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.23684
    Matthews' coefficent 2.04 Rfactor 0.17887
    Waters 100 Solvent Content 39.84

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rk5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch