The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a TetR/AcrR family transcriptional regulator from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2rae Target Id APC7479
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS5141,RHA08332_1_207, 101510 Molecular Weight 22960.59 Da.
    Residues 207 Isoelectric Point 5.13
    Sequence lrsrrkpssrigrrpsttqdristvgielfteqgfdatsvdevaeasgiarrtlfryfpsknaipwgdf dahlaemraqlaaqpddipivdgltaallqfnafpaseeinhrkrmglilrvpalqaysvvmyegwrnv iaeyvasrlgtsptdhvprtvgylllgvamsayeqwldddslelnellasgmqslydglsslgepdtrt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.25257
    Matthews' coefficent 2.46 Rfactor 0.23299
    Waters 39 Solvent Content 49.96

    Ligand Information


    Google Scholar output for 2rae

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch