.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r8r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-terminal region (19..243) of sensor protein KdpD from Pseudomonas syringae pv. tomato str. DC3000. To be Published
    Site MCSG
    PDB Id 2r8r Target Id APC86836.2
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS5869,AAO55761.1, BIG_523.1, 223283 Molecular Weight 24796.01 Da.
    Residues 225 Isoelectric Point 5.40
    Sequence rgrlkvflgaapgvgktyamlqaahaqlrqgvrvmagvvethgraeteallnglpqqpllrteyrgmtl eemdldallkaapslvlvdelahtnapgsrhtkrwqdiqellaagidvyttvnvqhleslndqvrgitg vqvretlpdwvlqeafdlvlidlpprellerlrdgkvyvpeqaraaidafftqtnltalremamqtaaa qvdndlaqgyrqlgqsap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.21642
    Matthews' coefficent 2.97 Rfactor 0.17073
    Waters 436 Solvent Content 58.56

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;PEG (DI(HYDROXYETHYL)ETHER) x 1;SO4 (SULFATE) x 5
    Metals

    Jmol

     
    Google Scholar output for 2r8r
    1. Structures of the OmpF porin crystallized in the presence of foscholine_12
    G Kefala, C Ahn, M Krupa, L Esquivies - Protein , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch