The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MTH_862 protein of unknown function from Methanothermobacter thermautotrophicus. To be Published
    Site MCSG
    PDB Id 2r47 Target Id APC5901
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus str. delta h
    Alias Ids TPS4913,AAB85360.1, 187420 Molecular Weight 16873.47 Da.
    Residues 153 Isoelectric Point 4.47
    Sequence meklkefrgikehlgvfreavkdaerigfagvpgvctpfaqlfayavrdkdnifipntdfskarklevt eygvelgeispgnvdvlvllgglsmpgigsdiedvkklvedaleeggelmglcymdmfaragwyelldf dcvinadidgyvlrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 1.88 Rfree 0.2207
    Matthews' coefficent 3.78 Rfactor 0.1922
    Waters 506 Solvent Content 67.46

    Ligand Information
    Ligands SO4 (SULFATE) x 5


    Google Scholar output for 2r47

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch