.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r41

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the protein of unknown function from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2r41 Target Id APC28898
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5426,AAO80632, 226185 Molecular Weight 12034.93 Da.
    Residues 107 Isoelectric Point 4.52
    Sequence mferfdsdrsryaslgvvsslpsglidsiwliidlnlkgviplndllhfdllnnngkvtvhfsqenssv emaidlpfsystaypsrifafddghretillpaemles
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.90 Rfree 0.241
    Matthews' coefficent 3.07 Rfactor 0.182
    Waters 102 Solvent Content 59.88

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r41

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch