The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of N-terminal domain of zonular occludens toxin from Neisseria meningitidis. To be Published
    Site MCSG
    PDB Id 2r2a Target Id APC84050.2
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5727,AAF41977.1, BIG_555.1, 122586 Molecular Weight 22274.56 Da.
    Residues 196 Isoelectric Point 7.78
    Sequence maeiclitgtpgsgktlkmvsmmandemfkpdengirrkvftnikglkiphtyietdakklpkstdeql sahdmyewikkpenigsivivdeaqdvwparsagskipenvqwlnthrhqgidifvltqgpklldqnlr tlvrkhyhiasnkmgmrtllewkicaddpvkmassafssiytldkkvydlyesaevht
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.82 Rfree 0.2144
    Matthews' coefficent 2.43 Rfactor 0.1757
    Waters 272 Solvent Content 49.36

    Ligand Information
    Ligands SO4 (SULFATE) x 2


    Google Scholar output for 2r2a

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch