The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the C-terminal domain of sex pheromone staph-cAM373 precursor from Staphylococcus aureus. TO BE PUBLISHED
    Site MCSG
    PDB Id 2qx2 Target Id APC23225.1
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mu50
    Alias Ids TPS5261,BAB58065.1, PF07537, 158878 Molecular Weight 38937.40 Da.
    Residues 341 Isoelectric Point 5.64
    Sequence pfkesqargllqdnmansynggdfedgllnlskevfptdkylyqdgqfldkktinaylnpkytkreidk msekdkkdkkanenlglnpshegetnpekiaekspaylsnileqdfygggdtkgknikgmtiglamnsv yyykkekdgptfskklddsevkkqgkqmaseilsrlrenddlkdipihfaiykqssedsitpgefitqa taeksqtklnewhnineksallpsstaadydenlnnnfkqfndnlqsyfsnftqavgkvkfvdkkpqrl vvdlpidyygqaetigitqyvteqankyfdkidnyeirikdgnqpralisktkddkepqvhiysn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.21701
    Matthews' coefficent 2.61 Rfactor 0.18138
    Waters 338 Solvent Content 52.90

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 5


    Google Scholar output for 2qx2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch