.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qqy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Ferritin like, Diiron-carboxylate Proteins from Bacillus anthracis str. Ames. To be Published
    Site MCSG
    PDB Id 2qqy Target Id APC89126
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS5941,NP_843494.1, 198094 Molecular Weight 16792.17 Da.
    Residues 146 Isoelectric Point 4.82
    Sequence mshdvkelieglnedlageysaiimynhnaatvsgiyrqvlkpffeseisdeqghalylaekiktlggt pttiplrvkqaedvremleyarqseyetikryekrkeqaanlnmtelvvkledmiadetnhmeeldrll ndkamvln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.245
    Matthews' coefficent 2.45 Rfactor 0.197
    Waters 128 Solvent Content 49.74

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qqy
    1. Cloning, purification and preliminary X-ray crystallographic analysis of a hypothetical protein, MJ0754, from Methanococcus jannaschii DSM 2661
    EH Lee, KH Nam, KY Hwang - Acta Crystallographica Section F: , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch