.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qmw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine. J.Struct.Biol. 162 94-107 2008
    Site MCSG
    PDB Id 2qmw Target Id APC85812
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mu50
    Alias Ids TPS5792,BAB58077.1, PF00800, 158878 Molecular Weight 29471.81 Da.
    Residues 264 Isoelectric Point 4.73
    Sequence mqlyylgpkgtfsylacrqyfseneatfqpksnlfevikavadddtsigvvpiensiegtinivadala qqdvfahgeirldinfalygngtdsisdikkvysiapaisqttnyihqhqfdydyvdstiqsltkieng vaaiaplgsgeaygftpidthiedyphnvtrflviknqqqfdqnatslmflitpmhdkpgllasvlntf alfninlswiesrplktqlgmyrffvqadsaittdikkviailetldfkvemigafn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.2761
    Matthews' coefficent 2.39 Rfactor 0.22488
    Waters 97 Solvent Content 48.47

    Ligand Information
    Ligands ACT (ACETATE) x 1;EDO (1,2-ETHANEDIOL) x 2;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2qmw
    1. Structures of open (R) and close (T) states of prephenate dehydratase (PDT)--Implication of allosteric regulation by l-phenylalanine
    K Tan, H Li, R Zhang, M Gu, ST Clancy - Journal of structural , 2008 - Elsevier
     
    2. Case Studies: Function Predictions of Structural Genomics Results
    JD Watson, JM Thornton - From Protein Structure to Function with , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch