.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qm0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of BES from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 2qm0 Target Id APC26071
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5342,AAP10660, 226900 Molecular Weight 30710.36 Da.
    Residues 272 Isoelectric Point 5.94
    Sequence mnttvekqqiitsnteqwkmysklegkeyqihiskpkqpapdsgypviyvldgnaffqtfheavkiqsv raektgvspaiivgvgypiegafsgeercydftpsviskdaplkpdgkpwpktggahnfftfieeelkp qieknfeidkgkqtlfghslgglfalhilftnlnafqnyfisspsiwwnnksvlekeenliielnnakf etgvfltvgslerehmvvganelserllqvnhdklkfkfyeaegenhasvvptslskglrfisyv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.84 Rfree 0.22828
    Matthews' coefficent 2.64 Rfactor 0.18444
    Waters 538 Solvent Content 53.46

    Ligand Information
    Ligands SO4 (SULFATE) x 5
    Metals

    Jmol

     
    Google Scholar output for 2qm0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch