.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qlc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of DNA repair protein RadC from Chlorobium tepidum TLS. To be Published
    Site MCSG
    PDB Id 2qlc Target Id APC86057.1
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS5814,AAM71853.1, PF04002, 194439 Molecular Weight 14142.52 Da.
    Residues 125 Isoelectric Point 7.28
    Sequence nlkvkgardvfeymkgripdetkehlfvlflstknqilrhetitigtltaslihpreifkaairesahs iilvhnhpsgdvqpsnadkqvtsilkkagdllqielldhvivgnndwfsfrdhall
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.30 Rfree 0.27385
    Matthews' coefficent 2.56 Rfactor 0.21586
    Waters 229 Solvent Content 51.92

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qlc

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch