.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pqv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MutT/nudix family protein from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 2pqv Target Id APC80193
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5585,AAK74305, 170187 Molecular Weight 17348.86 Da.
    Residues 151 Isoelectric Point 4.93
    Sequence mtqqdfrtkvdntvfgvratalivqnhkllvtkdkgkyytiggaiqvnestedavvrevkeelgvkaqa gqlafvvenrfevdgvsyhniefhylvdlledapltmqedekrqpcewidldklqniqlvpvflktalp dwegqlrhihlee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.63 Rfree 0.22646
    Matthews' coefficent 2.13 Rfactor 0.16695
    Waters 414 Solvent Content 42.13

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2pqv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch