The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the ATP-binding sugar transporter-like protein from Salmonella typhimurium. To be Published
    Site MCSG
    PDB Id 2pp6 Target Id APC23283
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5262,NP_460010, 99287 Molecular Weight 10868.93 Da.
    Residues 99 Isoelectric Point 9.03
    Sequence madlfdgmkrrmdaliaerfgmkvningtdcivvesdflaelgpvegngknvvvfsgnviprrgdrvvl rgseftvtrirrfngkpqltleennggkga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.279
    Matthews' coefficent 2.05 Rfactor 0.210
    Waters 28 Solvent Content 40.02

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 2pp6
    1. A common evolutionary origin for tailed-bacteriophage functional modules and bacterial machineries
    D Veesler, C Cambillau - Microbiology and Molecular Biology , 2011 - Am Soc Microbiol

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch