The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a protein Lpg0085 with unknown function (DUF785) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1. To be Published
    Site MCSG
    PDB Id 2pma Target Id APC86035.2
    Molecular Characteristics
    Source Legionella pneumophila subsp. pneumophila str. philadelphia 1
    Alias Ids TPS5807,AAU26192.1, PF05618, 272624 Molecular Weight 15880.69 Da.
    Residues 143 Isoelectric Point 9.92
    Sequence iygyvekatlidqnltlsakldtgaksaslhavniteiekkgipylrftvptktgdysfegeyvgkvki kvrssetnpgllrttpikrpvvllniklgdkvrtikvnltnrkrflyplllgrdaiidfngavdpaltf ttksk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.89 Rfree 0.21301
    Matthews' coefficent 2.58 Rfactor 0.18439
    Waters 114 Solvent Content 52.40

    Ligand Information
    Ligands ACT (ACETATE) x 5;FMT (FORMIC) x 5


    Google Scholar output for 2pma

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch