.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pli

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative Mg2+ and Co2+ transporter(CorC)associated region from Neisseria meningitidis MC58. To be Published
    Site MCSG
    PDB Id 2pli Target Id APC83979.1
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5724,AAF40966.1, PF03471, 122586 Molecular Weight 9791.32 Da.
    Residues 88 Isoelectric Point 4.89
    Sequence deddsadnihavsserwrihaateiedintffgteysseeadtigglviqelghlpvrgekvligglqf tvaradnrrlhtlmatrvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.21539
    Matthews' coefficent 2.91 Rfactor 0.17663
    Waters 455 Solvent Content 57.72

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;ACT (ACETATE) x 6
    Metals ZN (ZINC) x 13

    Jmol

     
    Google Scholar output for 2pli

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    2pli.png
    No description
    27.65 kB22:13, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch