.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p25

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the glyoxylase family protein from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2p25 Target Id APC29335
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5442,AAO81945, 226185 Molecular Weight 14717.98 Da.
    Residues 126 Isoelectric Point 5.11
    Sequence mffkeihhvainasnyqatknfyveklgfevlrenhrpekndikldlklgsqeleifisdqfparpsyp ealglrhlafkvehieeviaflneqgieteplrvddftgkkmtfffdpdglplelhe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.22958
    Matthews' coefficent 2.54 Rfactor 0.20075
    Waters 135 Solvent Content 51.51

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p25
    1. Collectins: sentinels of innate immunity
    G Gupta, A Surolia - Bioessays, 2007 - Wiley Online Library
     
    2. X-linked dominant scapuloperoneal myopathy is due to a mutation in the gene encoding four-and-a-half-LIM protein 1
    CM Quinzii, TH Vu, KC Min, K Tanji, S Barral - The American Journal of , 2008 - Elsevier
     
    3. Functional characterization of GATA3 mutations causing the hypoparathyroidism-deafness-renal (HDR) dysplasia syndrome: insight into mechanisms of DNA binding
    A Ali, PT Christie, IV Grigorieva, B Harding - Human molecular , 2007 - Oxford Univ Press
     
    4. Analysis of the GCM2 gene in isolated hypoparathyroidism: a molecular and biochemical study
    A Maret, C Ding, SL Kornfield - Journal of Clinical , 2008 - Endocrine Soc
     
    5. Pseudodominant inheritance of goitrous congenital hypothyroidism caused by TPO mutations: molecular and in silico studies
    J Deladoy, N Pfarr, JM Vuissoz, J Parma - Journal of Clinical , 2008 - Endocrine Soc
     
    6. Identification and characterization of novel parathyroid-specific transcription factor Glial Cells Missing Homolog B (GCMB) mutations in eight families with autosomal
    MR Bowl, SM Mirczuk, IV Grigorieva - Human molecular , 2010 - Oxford Univ Press
     
    7. Presence and significance of a R110W mutation in the DNA-binding domain of GCM2 gene in patients with isolated hypoparathyroidism and their family members
    N Tomar, H Bora, R Singh, N Gupta, P Kaur - European Journal of , 2010 - eje.org
     
    8. Bioinformatics of the urinary proteome.
    LD Parnell, CM Schueller - Methods in molecular biology (Clifton, NJ), 2010 - Springer
     
    9. Picobirnaviruses encode a protein with repeats of the ExxRxNxxxE motif
    B Da Costa, S Duquerroy, B Tarus, B Delmas - Virus Research, 2011 - Elsevier
     
    10. Human HAD phosphatases: structure, mechanism, and roles in health and disease
    A Seifried, J Schultz, A Gohla - FEBS Journal, 2012 - Wiley Online Library
     
    11. Congenital Goitrous Hypothyroidism: Mutation Analysis in the Thyroid Peroxidase Gene
    FS Belforte, MB Miras, MC Olcese - Clinical , 2011 - Wiley Online Library
     
    12. Molecular and genetic characterization of spinocerebellar ataxia type 5 (SCA5)
    KAD Krueger - 2008 - conservancy.umn.edu
     
    13. Human Metabolome Database Version 2.5
    S Class, S Class - Enzyme, 2008 - hmdb.ca
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch