.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p0n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of NMB1532 protein of unknown function from Neisseria meningitidis. To be Published
    Site MCSG
    PDB Id 2p0n Target Id APC83866
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5719,AAF41887.1, 122586 Molecular Weight 19334.94 Da.
    Residues 169 Isoelectric Point 4.86
    Sequence mnpfetksvtfaepiemlyachgkvrrfcgqvamlsdyiaengcnqivlqtirqiaqyfnvaaplhhed eeenffplllqyapqaqesvdellrqhiglhdnwaavsaefakleadnayvpdeeafkrfvagydvhla ieeplfdmgntfipkeklteigeimaarrrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.41 Rfree 0.2031
    Matthews' coefficent 2.17 Rfactor 0.1678
    Waters 425 Solvent Content 43.39

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 2;GOL (GLYCEROL) x 1
    Metals MN (MANGANESE) x 4;CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 2p0n
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Structural and Molecular Characterization of Iron-sensing Hemerythrin-like Domain within F-box and Leucine-rich Repeat Protein 5 (FBXL5)
    JW Thompson, AA Salahudeen, S Chollangi - Journal of Biological , 2012 - ASBMB
     
    3. A score of the ability of a three-dimensional protein model to retrieve its own sequence as a quantitative measure of its quality and appropriateness
    LP Martnez-Castilla, R Rodrguez-Sotres - PloS one, 2010 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch