.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ozz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of YhfZ from Shigella flexneri. To be Published
    Site MCSG
    PDB Id 2ozz Target Id APC28298
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5404,AAP19315, 198215 Molecular Weight 25410.57 Da.
    Residues 228 Isoelectric Point 4.93
    Sequence mdnkallshvdinnvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirvecllngvydmavvs rlaaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsrsadqkimtdvffgdsdvervd lsyheslqrivkgdvdaviwnvvaeneltmlgleatpltddprflqateavvltrvddypmqqllravv dkhallahqqrvvsgeqepsy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.288
    Matthews' coefficent 2.41 Rfactor 0.222
    Waters 166 Solvent Content 49.07

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2ozz
    1. A structural classification of substrate-binding proteins
    RPA Berntsson, SHJ Smits, L Schmitt, DJ Slotboom - FEBS letters, 2010 - Elsevier
     
    2. A structural classification of substrate-binding proteins
    PAB Ronnie, SHJ Smits, L Schmitt, DJ Slotboom - FEBS , 2010 - gbb.eldoc.ub.rug.nl
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch