.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ox6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of gene product SO3848 from Shewanella oneidensis MR-1. To be Published
    Site MCSG
    PDB Id 2ox6 Target Id APC83631
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS5705,NP_719380, 211586 Molecular Weight 18818.42 Da.
    Residues 166 Isoelectric Point 5.14
    Sequence mskniglnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldiddiiemqvlnt tdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawrikkecklvlevdvslinln veaykayreqnglsesresrakwaatql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.2393
    Matthews' coefficent 2.39 Rfactor 0.19901
    Waters 779 Solvent Content 48.48

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 10

    Jmol

     
    Google Scholar output for 2ox6
    1. The SeqFEATURE library of 3D functional site models: comparison to existing methods and applications to protein function annotation
    S Wu, MP Liang, RB Altman - Genome biology, 2008 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch