.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oqt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a putative PTS IIA domain from Streptococcus pyogenes M1 GAS. To be Published
    Site MCSG
    PDB Id 2oqt Target Id APC29699
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5472,AAK33276, 160490 Molecular Weight 17474.07 Da.
    Residues 161 Isoelectric Point 4.56
    Sequence mnlkqafidnnsirlglsadtwqeavrlavqplidskavtsayydaiiastekygpyyvlmpgmampha eaglgvnrnafalitltkpvtfsdgkevsvlltlaatdpsihttvaipqivalfeldnaierlvacqsp kevlemveeskdspylegmdlna
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.41 Rfree 0.25445
    Matthews' coefficent 2.42 Rfactor 0.20787
    Waters 14 Solvent Content 49.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oqt
    1. Crystal Structures of Phosphotransferase System Enzymes PtxB (IIBAsc) and PtxA (IIAAsc) from Streptococcus mutans
    J Lei, LF Li, XD Su - Journal of molecular biology, 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch