.
The Open Protein Structure Annotation Network
PDB Keyword
.

2okg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of the effector-binding domain of repressor Central glycolytic gene Regulator from Bacillus subtilis reveal ligand-induced structural changes upon binding of several glycolytic intermediates. Mol.Microbiol. 69 895-910 2008
    Site MCSG
    PDB Id 2okg Target Id APC85550
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS5777,CAB15400.1, PF04198, 224308 Molecular Weight 27249.73 Da.
    Residues 252 Isoelectric Point 5.92
    Sequence kdvlgltllektlkerlnlkdaiivsgdsdqspwvkkemgraavacmkkrfsgknivavtggttieava emmtpdsknrellfvpargglgedvknqanticahmaekasgtyrllfvpgqlsqgayssiieepsvke vlntiksasmlvhgigeaktmaqrrntpledlkkiddndavteafgyyfnadgevvhkvhsvgmqlddi daipdiiavaggsskaeaieayfkkprntvlvtdegaakkllrde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.23871
    Matthews' coefficent 2.30 Rfactor 0.19575
    Waters 472 Solvent Content 46.56

    Ligand Information
    Ligands G3H (GLYCERALDEHYDE-3-PHOSPHATE) x 1
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 2okg
    1. Fructose-1, 6-bisphosphate acts both as an inducer and as a structural cofactor of the central glycolytic genes repressor (CggR)
    S Zorrilla, D Chaix, A Ortega, C Alfonso, T Doan - Biochemistry, 2007 - ACS Publications
     
    2. A phospho_sugar binding domain homologous to NagB enzymes regulates the activity of the central glycolytic genes repressor
    T Doan, L Martin, S Zorrilla, D Chaix - Proteins: Structure, , 2008 - Wiley Online Library
     
    3. Crystal structures of the effector_binding domain of repressor Central glycolytic gene Regulator from Bacillus subtilis reveal ligand_induced structural changes upon
    P _ez_ov, M Koek, SF Moy - Molecular , 2008 - Wiley Online Library
     
    4. Crystal structure of the full-length sorbitol operon regulator SorC from Klebsiella pneumoniae: structural evidence for a novel transcriptional regulation mechanism
    D de Sanctis, CE McVey, FJ Enguita - Journal of molecular , 2009 - Elsevier
     
    5. Physical basis of the inducer-dependent cooperativity of the Central glycolytic genes Repressor/DNA complex
    D Chaix, ML Ferguson, C Atmanene - Nucleic acids , 2010 - Oxford Univ Press
     
    6. Dynamic features of homo_dimer interfaces calculated by normal mode analysis
    Y Tsuchiya, K Kinoshita, S Endo, H Wako - Protein Science, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch